간 카<sup> 2 +</sup> – 파도 갭 접합 채널 hemichannels에 의해 구동됩니다. 여기, 우리는 세포 간 칼슘을 측정하는 방법을 설명<sup> 2 +</sup> – 파 지역의 단일 셀 기계적 자극과 속성과 간격 접합 채널 hemichannels의 규정을 조사하기 위해 해당 응용 프로그램의 질문에 답변 세포 단층합니다.
간 통신은 뇌, 간, 망막, 달팽이관 및 혈관 등의 장기와 조직의 다양한 세포 사이의 생리적 인 과정의 조정을 위해 필수적이다. 실험 설정에서, 세포 간 칼슘 2 + – 파도 하나의 세포에 기계적 자극을 적용하여 이끌어 할 수 있습니다. 이 세포 내 신호 IP 분자 3 칼슘의 출시에 이르게 + 이웃 세포에 기계적 자극 셀에서 + 파 동심 칼슘의 번식을 시작합니다. 간 칼슘 2 + 파 전파를 제어하는 주요 분자 경로는 IP 3의 직접 전송을 통해와 ATP의 방출을 통해 hemichannels으로 갭 접합 채널에 의해 제공됩니다. 속성과 다른 넥신 갭 접합 채널 hemichannels로 pannexin 이소 규제의 식별 및 특성화 quantificatio에서 허용하는N 간 칼슘 2 + 파, siRNA를, 그리고 갭 접합 채널 hemichannels 억제제의 사용의 확산. 여기, 우리는 그 결과로 간 칼슘이 세포의 급성, 짧은 지속 변형에 의해 자극 통제 및 지역화 기계적 자극에 대한 응답으로 Fluo4 암으로로드 차 각막 내피 세포의 단일 층에있는 + 파를 측정하는 방법을 설명 이하 1 ㎛의 팁 직경 micromanipulator에 제어 유리 micropipette를 가진 세포막을 감동. 우리는 또한 주 소 각막 내피 세포와 + – 파도 ATP의 방출을 통한 세포 간 칼슘의 중심 세력으로 Cx43-hemichannel 활동을 평가하기위한 모델 시스템으로 사용의 분리를 설명합니다. 마지막으로, 우리는 사용, 장점, 한계와 갭 접합 채널 hemichannel 연구의 맥락에서이 방법의 대안을 논의한다.
간 통신 및 신호는 조직과 전체 – 장기 레벨 1,2에서 세포 촉진제 님의 질문에 생리적 인 과정의 조정을 위해 필수적입니다. 간 의사 소통의 가장 직접적인 방법은 간격 접속점의 발생에 의해 만들어집니다. 갭 접합 3,4 인접 셀의 두 넥신 (CX는) hemichannels (그림 1)의 헤드 투 헤드 도킹에 의해 형성 단백질 성 채널입니다 간격 접합 채널의 패이다. 갭 접합 발생 및 변조 칼슘 이웃 세포 6 (그림 2)의 세포 내 상점에서 + 릴리스., 칼슘 2 + 또는 IP 5 등 이하 1.5 kDa의 분자량은 작은 신호 분자의 통과를 허용 갭 접합 채널은 밀접하게 산화 환원 수정 및 같은 내 및 분자간 단백질 상호 작용에 의해 및 세포 신호 전달 과정에 의해 조절된다인산화 7. GJS 그로 인하여 화학 및 전기 syncytium 역할, 연결된 세포의 조정 반응을 촉진한다. 예를 들어, 심방 및 심실 근육 세포를 통해 심장 활동 전위의 확산은 CX-기반 GJ 채널 85에 의해 중재된다. CXS는 갭 접합 채널로서 역할을 할뿐만 아니라 짝 hemichannels을 형성하여 정기적으로 이온 채널 8-10 (그림 1)과 유사 세포막 채널로 작동하지 않습니다. Hemichannels는 내부와 세포 외 환경 사이 이온 및 신호 분자의 교환을 제어하여 이웃 세포 사이 paracrine 신호에 참여할 수 있습니다.
많은 종류의 세포 (상피 세포, 조골 세포, 성상 세포, 내피 세포 등과 같은) 및 장기 (뇌, 간, 망막, 달팽이관과 혈관 등)에 간 칼슘 2 + – 파도 다세포 반응의 조정을위한 기본적인 <suP> 11. 특정 셀에 내 Ca 2 + 농도의 증가는이 셀로 제한하지만, 그로 인하여 간 칼슘 2 + 파 12,13 구축, 주변 이웃 세포에 전달되지 않습니다. 이러한 세포 간 칼슘 2 + – 파도 syncytium과 조절 장애는 병태 생리 학적 과정 11과 관련되어 같은 셀 계층의 정상적인 생리 조절을 위해 중요하다. 각막 내피 세포와 상피 세포에서, 우리 자신의 25-33 등 다른 그룹 14-24은 간 통신 메커니즘과 역할을 공부했다. 비 흥분 세포, 각막 내피 세포와 같은 세포 간 의사 소통의 두 가지 모드는 28,29, 즉 갭 접합 간 통신 및 paracrine 간 통신을 발생합니다. 갭 접합 간 통신 간격 분기점 7을 통해 신호 분자의 직접 교환을 포함한다. 갭 접합부tional 간 통신, 조직의 항상성을 유지하는 세포 증식을 조절하고, 세포 스트레스 10,34,35에 동기화 응답을 설정하기위한 중요합니다. 병리 번호, 갭 접합 커플 링으로 인해 결함이 CXS로 감소하고, 이에 갭 접합 간 통신이 36에 영향을 미치고있다. 이 다세포 생물의 격차 접합부 간 의사 소통의 중요성과 영향력을 강조한다. 그것이 확산 성 세포 메신저 (그림 2)의 방출을 포함 이후 격차 접합부 간 통신 대조적으로, paracrine 간 통신, 세포 – 세포 동격에 종속되지 않습니다. 신호 분자의 종류는 세포 신호에 의해 세포 공간에 해제됩니다. 분자 다음은 특정 수용체 단백질에 의해 감지 된 대상 셀에 전송됩니다. 이후 수용체 신호 단지 어떤 세포 반응을 유도신호를 비활성화 또는 탈감작의 제거에 의해 종료됩니다. 출시 친 화성 세포 신호 메신저 멤브레인을 통과하고 세포 내 수용체에 작용합니다. 반면, 친수성 메신저는 응답 세포의 세포막을 통과하지 않는다, 그러나 세포 내 환경에 신호를 중계 표면 발현 수용체 단백질에 결합하는 리간드 역할을합니다. 이온 채널 연결, 효소 결합, 및 G 단백질 – 연결 : 세포 표면 수용체 단백질의 세 가지 주요 가정은이 과정에 참여한다. 발표 메신저 분자가 가까이 (paracrine)에서 표적 세포에 동일한 셀 (autocrine)의 수용체에 작용하거나 순환 시스템 (내분비)가 필요 먼 표적 세포에.
각막 내피 세포 28,29 등 많은 종류의 세포에서, ATP는 세포 간 칼슘 2 + – 파도 37-40의 번식을 구동 주요 친수성, paracrine 요인 중 하나입니다. 지속여러 에이전트가 ING 기계적 변형, 저산소증, 염증이나 자극, ATP는 전단 응력, 스트레칭, 또는 삼투는 44,45 붓기에 대한 응답으로 41-44 건강한 세포에서 해제 할 수 있습니다. 다른 ATP 방출 메커니즘은 기공을 갖는 exocytosis를 44과 같은 ATP 결합 카세트 (ABC) 전송기, plasmalemmal 전압에 의존하는 음이온 채널 46, P2X7 수용체의 채널 47,48뿐만 아니라, 같은 전송 메커니즘의 과다 등 가정되었다 넥신의 hemichannels 49-52과 pannexin의 hemichannels 43,49,53. 세포 ATP는 ADP, AMP에 빠르게 가수 분해와 세포 외 환경에 존재하는 ectonucleotidases로 54,55를 아데노신 수 있습니다. extracellularly 발표 ATP와 그 대사 산물 ADP 56 확산을 통해 확산됩니다. 이웃 세포에서 퓨린 수용체 이러한 뉴클레오티드의 연속적인 상호 작용은 P에 연루되어있다간 칼슘 2 + – 파도 28,37,51의 ropagation. 퓨린 수용체의 두 가지 클래스가 존재한다 : 두 퓨린 (ATP, ADP)과 피리 미딘 (UTP, UDP) 뉴클레오티드 가장 P2-purinoceptors 57에 따라 행동하면서 아데노신은 P1-purinoceptors의 주요 천연 리간드이다.
간 통신 등의 부스러기 로딩, 염료 전송, IP 3 칼슘 2 +, 기계적 자극, 등과 같은 작용제 지역의 uncaging 등 다양한 방법으로 조사 할 수 있습니다. 여기에서 우리는 + 웨이브 전파는 단일 세포의 기계적 자극으로 이끌어 칼슘의 연구를 설명합니다. 기계적 자극에 의해 칼슘 2 + 파 전파 연구의 장점은 + 파 시간에 칼슘의 확산을 정량화하기 쉬운 도구를 제공하고 정량적으로 세포의 다른 전처리를 비교 할 수 있다는 것입니다. 각막 내피 세포에서 이러한 세포 간 칼슘 2 + – 파도 공동 수단층에서 조정 된 응답, 이에 안구 수술하는 동안 세포 스트레스를 견딜 수있는 내피를 돕는 비 재생 각막 내피 세포의 가능한 방어 메커니즘으로 작용 또는 면역 거부 또는 포도막염 58,59 동안 염증 매개체에 노출에.
이 논문에서, 우리는 마이크로 피펫을 사용하여 지역화 및 제어 기계 자극을 제공함으로써 주 소 각막 내피 세포의 단일 층에 간 칼슘 2 + 파 전파를 측정하는 간단한 방법을 설명합니다. 기계적 자극 세포는 +, 둘은 간 칼슘 2 + 파 전파 11,67 운전 필수적인 세포 내 신호 전달 분자 세포 내 IP 3 칼슘 2 지역의 증가와 함께 응답합니다. 칼슘 2 + h…
The authors have nothing to disclose.
실험실에서 수행 된 연구 활동은 연구 재단의 보조금에 의해 지원되었다 – 플랑드르 (FWO, 부여 번호 G.0545.08 및 G.0298.11) Interuniversity 장르 폴란드 프로그램 (벨기에 과학 정책, 허가 번호 P6/28 및 P7/13) 그리고 FWO 지원 연구 커뮤니티에 포함됩니다. 플랑드르 (FWO) – CDH는 연구 재단의 박사후 사람입니다. 저자는 매우 분자 및 세포 신호 (KU 루벤), 박사 SP 스 리니 (시력 측정법의 인디애나 대학 학교, USA) 박사 Leybaert의 연구실 (겐트 대학교)의 연구소의 모든 현재 및 이전 회원들에게 감사와 있습니다 도움이 토론을 제공하는 박사 Vinken은 (VUB), 절차를 최적화하거나 넥신 hemichannels의 연구 도구의 개발에 참여했다.
Name of Reagent/Material | Company | Catalog Number | Column1 |
Earle’s Balanced Salt Solution (EBSS) | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 14155-048 | |
Iodine | Sigma-Aldrich (Deisenhofen, Germany) | 38060-1EA | |
Dulbecco’s Modified Eagle’s Medium (DMEM) | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 11960-044 | |
L-glutamine (Glutamax) | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 35050-038 | |
Amphotericin-B | Sigma-Aldrich (Deisenhofen, Germany) | A2942 | |
Antibiotic-antimycotic mixture | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 15240-096 | |
Trypsin | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 25300-054 | |
Dulbecco’s PBS | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 14190-091 | |
Fluo-4 AM | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | F14217 | |
ARL-67156 (6-N,N-Diethyl-b,g-dibromomethylene-D-ATP) | Sigma-Aldrich (Deisenhofen, Germany) | A265 | |
Apyrase VI | Sigma-Aldrich (Deisenhofen, Germany) | A6410 | |
Apyrase VII | Sigma-Aldrich (Deisenhofen, Germany) | A6535 | |
Gap26 (VCYDKSFPISHVR) | Custom peptide synthesis | ||
Gap27 (SRPTEKTIFII) | Custom peptide synthesis | ||
Control Peptide (SRGGEKNVFIV) | Custom peptide synthesis | ||
siRNA1 Cx43 (sense: 5’GAAGGAGGAGGAACU-CAAAdTdT) | Annealed siRNA was purchased at Eurogentec (Luik, Belgium) | ||
siRNA2 Cx43 (sense: 5’CAAUUCUUCCUGCCGCAAUdTdT) | Annealed siRNA was purchased at Eurogentec (Luik, Belgium) | ||
siRNA scramble: scrambled sequence of siCx43-1 (sense: 5’GGUAAACG-GAACGAGAAGAdTdT) | Annealed siRNA was purchased at Eurogentec (Luik, Belgium) | ||
TAT-L2 (TAT- DGANVDMHLKQIEIKKFKYGIEEHGK) | Thermo Electron (Ulm, Germany) | ||
TAT-L2-H126K/I130N (TAT-DGANVDMKLKQNEIKKFKYGIEEHGK) | Thermo Electron (Ulm, Germany) | ||
Two chambered glass slides | Laboratory-Tek Nunc (Roskilde, Denmark) | 155380 | |
Confocal microscope | Carl Zeiss Meditec (Jena, Germany) | LSM510 | |
Piezoelectric crystal nanopositioner (Piezo Flexure NanoPositioner) | PI Polytech (Karlsruhe, Germany) | P-280 | |
HVPZT-amplifier | PI Polytech (Karlsruhe, Germany) | E463 HVPZT-amplifier | |
Glass tubes (glass replacement 3.5 nanoliter) | World Precision Instruments, Inc. Sarasota, Florida, USA | 4878 | |
Microelectrode puller | Zeitz Instrumente (Munchen, Germany) | WZ DMZ-Universal Puller |