Ca אינטר<sup> 2 +</sup> גלים מונעים על ידי ערוצי צומת גאפ וhemichannels. כאן, אנו מתארים שיטה למדידת Ca אינטר<sup> 2 +</sup> גלים בmonolayers הסלולרי בתגובה לגירוי מכאני מתא בודד מקומי והיישום שלה כדי לחקור את המאפיינים והרגולציה של ערוצי צומת גאפ וhemichannels.
תקשורת בין תאית היא חיונית לתיאום של תהליכים פיסיולוגיים בין תאים במגוון רחב של איברים ורקמות, ובכלל זה המוח, הכבד, הרשתית, השבלול וכלי הדם. בהגדרות ניסוי, אינטר Ca 2 + גלים יכול להיות שהושרו על ידי יישום גירוי מכאני לתא בודד. זה מוביל לשחרור של מולקולות האיתות תאיות IP 3 ו Ca 2 + שיזמו את ההתפשטות של Ca 2 + גל מעגלי מתא מגורה מכאני לתאים השכנים. את המסלולים המולקולריים המרכזיים השולטים 2 התפשטות אינטר + גל Ca מסופקים על ידי ערוצי צומת פער עד להעברה הישירה של 3-IP ועל ידי hemichannels דרך שחרורו של ה-ATP. זיהוי והאפיון של המאפיינים והרגולציה של connexin שונה וisoforms pannexin כערוצי צומת גאפ וhemichannels מותר על ידי quantification של התפשטות Ca אינטר 2 + גל, siRNA, ושימוש במעכבים של ערוצי צומת גאפ וhemichannels. כאן, אנו מתארים שיטה למדידה אינטר Ca 2 + גל בmonolayers של תאי האנדותל בקרנית עיקריים עמוסים Fluo4-AM בתגובה לגירוי מכאני מבוקר ומקומי עורר על ידי עיוות חריפה, קצר טווח של התא כתוצאה נגיעה של קרום התא עם micropipette זכוכית micromanipulator שליטה בקוטר קצה מיקרומטר פחות מ 1. אנו גם מתארים את הבידוד של תאים ראשוניים שור קרנית האנדותל והשימוש בו כמערכת מודל להערכת פעילות Cx43-hemichannel ככוח מונע לאינטר Ca 2 + גלים דרך שחרורו של ה-ATP. לבסוף, אנו דנים בשימוש, יתרונות, מגבלות וחלופות של שיטה זו בהקשר של ערוץ צומת פער ומחקר hemichannel.
תקשורת בין תאית ואיתות חיונית לתיאום של תהליכים פיסיולוגיים בתגובה לאגוניסטים תאיים ברמה 1,2 כל האיבר והרקמה. הדרך הישירה ביותר של תקשורת בין תאית נוצרה על ידי ההתרחשות של צמתים פער. צמתים פער הם לוחות של ערוצי צומת גאפ, שהם ערוצים חלבוניים שהוקמו על ידי העגינה הראש בראש של שתי connexin (CX) hemichannels של תאים סמוכים 3,4 (איור 1). צמתים פער לאפשר המעבר של מולקולות איתות קטנות עם משקל מולקולרי של פחות מ -1.5 kDa, כולל Ca 2 + או ה-IP של 3 5, מה שגרם וויסות Ca 2 + שחרור מהחנויות תאיות של התאים השכנים 6 (איור 2). ערוצי צומת פער מוסדרים היטב על ידי אינטראקציות חלבון ותוך מולקולאריים ועל ידי תהליכי איתות תאיים, כמו שינוי והחיזורזירחון 7. GJS להקל על התגובה מתואמת של תאים מחוברים, ובכך מתנהג כמו כימי וsyncytium חשמל. לדוגמה, הפצה של פוטנציאל פעולת לב על פני myocytes פרוזדורים וחדרים מתווכת על ידי ערוצי 85 GJ מבוסס CX. CXS יש לא רק תפקיד כערוצי צומת פער, אלא גם ליצור hemichannels מזווג, ובכך מתפקד כערוצים בקרום בדומה לערוצים רגילים יון 8-10 (איור 1). Hemichannels להשתתף באיתות בין תאים שכנים paracrine על ידי שליטה בחילופי יונים ומולקולות איתות בין סביבת התוך תאית ו.
בסוגי תאים רבים (כמו תאי אפיתל, תאי osteoblastic, האסטרוציטים, תאי אנדותל, וכו ') ואיברים (כמו מוח, כבד, רשתית, שבלול וכלי דם), אינטר Ca 2 + גלים הם יסוד לתיאום של תגובות תאיות <sup> 11. עליות בCa 2 + רמות תאיות בתא מסוים אינן מוגבלות לתא זה, אבל להפיץ לתאים השכנים בסביבה, וכך לבסס Ca אינטר 2 + גל 12,13. Ca 2 + אלה אינטר גלים חשובים לויסות פיזיולוגית נורמלית של שכבות תאים כsyncytium וdysregulation נקשר עם תהליכי pathophysiological 11. באנדותל ואפיתל קרני, קבוצות שונות 14-24, כולל 25-33 משלנו, חקרו את המנגנונים ואת התפקידים של תקשורת בין תאית. בתאים שאינם נרגשים, כמו תאי אנדותל בקרנית, שני מצבים שונים של תקשורת בין תאית להתרחש 28,29, כלומר פער תקשורת בין תאית junctional ותקשורת בין תאית paracrine. תקשורת בין תאית junctional פער כרוכה בחילופים ישירים של מולקולות איתות דרך צמתים פער 7. פער juncתקשורת בין תאית tional היא קריטית לשמירה על הומאוסטזיס רקמות, השליטה התפשטות תאים, והקמה מסונכרנת תגובה ללחץ תאי 10,34,35. במספר פתולוגיות, צימוד צומת פער מצטמצם עקב פגום CXS, ומשפיע על פער תקשורת בין תאית 36 junctional בזאת. זה מדגיש את החשיבות והשפעה של תקשורת בין תאית junctional פער באורגניזמים תאיים. בניגוד לתקשורת בין תאית junctional פער, תקשורת בין תאית paracrine אינה תלויה בפרד תאי תאים, שכן היא כוללת את שחרורו של שליחים תאיים diffusible (איור 2). סוגים שונים של מולקולות איתות משתחררים בחלל החוץ התאי על ידי תאי איתות. המולקולה לאחר מכן הועברה לתא היעד שבו הוא זוהה על ידי חלבון קולטן ספציפי. כתוצאה מכך מורכבת קולט האותות גורם לתגובה תאית, אשרהוא הופסק על ידי הסרת האות, איון או הפחתת רגישות. שליחים תאיים lipophilic פורסם איתות לחדור את הקרום ולפעול על קולטני תאיות. בניגוד לכך, שליחים הידרופילי לא לחצות את קרום הפלזמה של התא להגיב, אבל לפעול כיגנד שנקשר לחלבוני פני שטח, הביעו הקולטן, אשר לאחר מכן להעביר את האות לסביבה תאית. שלוש משפחות עיקריות של חלבונים פני תא קולטן להשתתף בתהליך הזה: קשור יון ערוצים, אנזים צמוד וצמוד לחלבון G. מולקולת השליח שוחרר יכולה לפעול על הקולטנים של אותו התא (autocrine), על תאי המטרה בסמיכות (paracrine), או על תאי היעד רחוקים שדורשים מערכת הדם (האנדוקרינית).
בסוגי תאים רבים, כולל קרנית האנדותל 28,29, ה-ATP הוא אחד הגורמים העיקריים paracrine הידרופילי, המניעים את ההתפשטות של אינטר Ca 2 + גלים 37-40. משךעיוות מכאנית ing, היפוקסיה, דלקת או גירוי על ידי סוכנים שונים, ניתן לשחרר ATP מהתאים בריאים 41-44 בתגובה למאמץ גזירה, מתיחה, או נפיחות האוסמוטי 44,45. מנגנוני ה-ATP-הפצה אחרות כבר הניחו, כולל exocytosis לפוחי 44 ושפע של מנגנוני הובלה, כגון ה-ATP מחייבים קלטות (ABC) מובילים, ערוצי אניון מתח התלויים plasmalemmal 46, P2X7 ערוצי קולט 47,48, כמו גם connexin hemichannels 49-52 וpannexin hemichannels 43,49,53. ATP תאי יכול להיות במהירות הידרוליזה לADP, AMP ואדנוזין 54,55 ידי ectonucleotidases שנמצאים בסביבה תאית. ה-ATP שפורסם extracellularly וADP המטבוליט שלה 56 תהיה להפיץ באמצעות דיפוזיה. האינטראקציה הבאה של נוקלאוטידים אלה עם קולטני purinergic בתאים השכנים הייתה מעורבת בעמ 'ropagation של אינטר Ca 2 + גלים 28,37,51. שני סוגים של קולטנים שונים purinergic נוכחים: אדנוזין הוא ליגנד הטבעי העיקרי לP1-purinoceptors, בעוד הן פורין (ATP, ADP) ופירימידין (UTP, UDP) נוקלאוטידים ביותר לפעול על P2-purinoceptors 57.
תקשורת בין תאית יכולה להיחקר על ידי שיטות שונות כגון טעינה לגרד, העברת צבע, משחררות רפרוף מקומית של אגוניסטים כמו IP 3 וCa 2 +, גירוי מכאני, וכו '. כאן אנו מתארים את המחקר של Ca 2 + התפשטות גל שהושרו על ידי גירוי מכאני של תא בודד. היתרון של לימוד 2 + התפשטות גל CA על ידי גירוי מכאני הוא שהיא מספקת כלי קל לכמת את התפשטות Ca 2 + גל לאורך זמן, והיא מאפשרת השוואת כמותית pretreatments של התאים שונים. באנדותל בקרנית, אלה Ca 2 + אינטר גלים לאפשר שיתוףתגובה מתואמת מmonolayer, מתנהגת בזאת כמנגנון הגנה אפשרי של האנדותל של הקרנית שאינם משובי עוזרים האנדותל לעמוד לחצים תאיים במהלך ניתוח תוך עיני, או בחשיפה למתווכים דלקתיים במהלך דחייה של מערכת חיסון או אובאיטיס 58,59.
בכתב יד זה, אנו מתארים שיטה פשוטה למדידת 2 + אינטר התפשטות גל CA בmonolayers של תאי האנדותל בקרנית שור ראשוניים על ידי מתן גירוי מכאני מקומית ומבוקר באמצעות micropipette. תאי מגורה מכאני מגיבים בעלייה מקומית בIP תאי 3 וCa 2 +, אשר שניהם הם מולקולות איתות תאיות חיוניות…
The authors have nothing to disclose.
עבודת מחקר שבוצעה במעבדה נתמכה על ידי מענקי קרן המחקר – פלנדריה (FWO; מספרי מענק G.0545.08 וG.0298.11), תכנית הפולנים המשיכה הבינאוניברסיטאי (מדיניות מדע בלגית; מענק מספר P6/28 וP7/13) ומוטבע בקהילת מחקר FWO נתמכת. CDH הוא פוסט דוקטורט של קרן המחקר – פלנדריה (FWO). המחברים מודים מאוד לכל חברי ההווה ובעבר של המעבדה של איתות מולקולרית ותאית (KU לובן), ד"ר SP Srinivas (אוניברסיטת אינדיאנה הספר לאופטומטריה, ארה"ב), המעבדה של ד"ר Leybaert (אוניברסיטת גנט) ושל ד"ר Vinken (Vub) שסיפק דיונים מועילים, מותאם נהלים או היו מעורב בפיתוח כלים לחקר hemichannels connexin.
Name of Reagent/Material | Company | Catalog Number | Column1 |
Earle’s Balanced Salt Solution (EBSS) | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 14155-048 | |
Iodine | Sigma-Aldrich (Deisenhofen, Germany) | 38060-1EA | |
Dulbecco’s Modified Eagle’s Medium (DMEM) | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 11960-044 | |
L-glutamine (Glutamax) | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 35050-038 | |
Amphotericin-B | Sigma-Aldrich (Deisenhofen, Germany) | A2942 | |
Antibiotic-antimycotic mixture | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 15240-096 | |
Trypsin | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 25300-054 | |
Dulbecco’s PBS | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 14190-091 | |
Fluo-4 AM | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | F14217 | |
ARL-67156 (6-N,N-Diethyl-b,g-dibromomethylene-D-ATP) | Sigma-Aldrich (Deisenhofen, Germany) | A265 | |
Apyrase VI | Sigma-Aldrich (Deisenhofen, Germany) | A6410 | |
Apyrase VII | Sigma-Aldrich (Deisenhofen, Germany) | A6535 | |
Gap26 (VCYDKSFPISHVR) | Custom peptide synthesis | ||
Gap27 (SRPTEKTIFII) | Custom peptide synthesis | ||
Control Peptide (SRGGEKNVFIV) | Custom peptide synthesis | ||
siRNA1 Cx43 (sense: 5’GAAGGAGGAGGAACU-CAAAdTdT) | Annealed siRNA was purchased at Eurogentec (Luik, Belgium) | ||
siRNA2 Cx43 (sense: 5’CAAUUCUUCCUGCCGCAAUdTdT) | Annealed siRNA was purchased at Eurogentec (Luik, Belgium) | ||
siRNA scramble: scrambled sequence of siCx43-1 (sense: 5’GGUAAACG-GAACGAGAAGAdTdT) | Annealed siRNA was purchased at Eurogentec (Luik, Belgium) | ||
TAT-L2 (TAT- DGANVDMHLKQIEIKKFKYGIEEHGK) | Thermo Electron (Ulm, Germany) | ||
TAT-L2-H126K/I130N (TAT-DGANVDMKLKQNEIKKFKYGIEEHGK) | Thermo Electron (Ulm, Germany) | ||
Two chambered glass slides | Laboratory-Tek Nunc (Roskilde, Denmark) | 155380 | |
Confocal microscope | Carl Zeiss Meditec (Jena, Germany) | LSM510 | |
Piezoelectric crystal nanopositioner (Piezo Flexure NanoPositioner) | PI Polytech (Karlsruhe, Germany) | P-280 | |
HVPZT-amplifier | PI Polytech (Karlsruhe, Germany) | E463 HVPZT-amplifier | |
Glass tubes (glass replacement 3.5 nanoliter) | World Precision Instruments, Inc. Sarasota, Florida, USA | 4878 | |
Microelectrode puller | Zeitz Instrumente (Munchen, Germany) | WZ DMZ-Universal Puller |