الكالسيوم بين الخلايا<sup> 2 +</supهي التي تحرك> موجات عبر قنوات تقاطع الفجوة وhemichannels. هنا، نحن تصف طريقة لقياس الكالسيوم بين الخلايا<sup> 2 +</sup> موجات في الخلية monolayers في استجابة لحافز الميكانيكية وحيدة الخلية المحلية وتطبيقه على التحقيق في خصائص وتنظيم قنوات تقاطع الفجوة وhemichannels.
الاتصالات بين الخلايا أمر ضروري لتنسيق العمليات الفسيولوجية بين الخلايا في مجموعة متنوعة من الأجهزة والأنسجة، بما في ذلك الدماغ والكبد، شبكية العين، القوقعة والأوعية الدموية. في إعدادات التجريبية، بين الخلايا كا 2 + موجات يمكن استخلاصها من خلال تطبيق التحفيز الميكانيكي لخلية واحدة. وهذا يؤدي إلى الإفراج عن الجزيئات داخل الخلايا مما يشير IP 3 والكالسيوم 2 + التي بدء انتشار كا 2 + الموجة بتكثف من الخلية حفز ميكانيكيا إلى الخلايا المجاورة. يتم توفير المسارات الجزيئية الرئيسية التي تتحكم بين الخلايا كا 2 + انتشار الموجة عبر قنوات تقاطع الفجوة من خلال نقل مباشر من IP (3) وhemichannels من خلال الافراج عن ATP. ويسمح تحديد وتوصيف خصائص وتنظيم connexin مختلفة والأشكال الإسوية pannexin كقنوات تقاطع الفجوة وhemichannels من قبل quantificatioن من انتشار الكالسيوم بين الخلايا 2 + الموجة، سيرنا، واستخدام مثبطات قنوات تقاطع الفجوة وhemichannels. هنا، نحن تصف طريقة لقياس بين الخلايا كا 2 + الموجة في الطبقات الوحيدة من الخلايا البطانية القرنية الأولية محملة Fluo4-AM ردا على التحفيز الميكانيكي للرقابة والمترجمة استفزاز من قبل، وتشوه قصيرة الأمد الحاد في الخلية نتيجة لذلك من لمس غشاء الخلية مع micropipette الزجاج التي تسيطر عليها مياداة مجهرية التي يبلغ قطرها غيض من أقل من 1 ميكرون. نحن أيضا وصف عزلة الابتدائي الأبقار الخلايا البطانية القرنية واستخدامه كنظام نموذج لتقييم النشاط Cx43-hemichannel باعتبارها القوة يحركها لبين الخلايا كا 2 + موجات من خلال الافراج عن ATP. وأخيرا، نحن مناقشة استخدام، ومزايا والقيود والبدائل لهذا الأسلوب في سياق الفجوة قناة تقاطع والبحوث hemichannel.
الاتصالات بين الخلايا وإشارات ضرورية لتنسيق العمليات الفسيولوجية في استجابة لمنبهات خارج الخلية في الأنسجة و1،2 مستوى كامل الجهاز. يتم إنشاء الطريق الأكثر مباشرة للاتصال بين الخلايا من حدوث تقاطعات الفجوة. تقاطعات الفجوة هي لويحات من القنوات تقاطع الفجوة، والتي هي القنوات البروتينية التي شكلتها لرسو السفن وجها لوجه من اثنين connexin (CX) hemichannels من الخلايا المتجاورة 3،4 (الشكل 1). تقاطعات الفجوة تسمح بمرور الجزيئات الصغيرة إشارة ذات وزن جزيئي أقل من 1.5 كيلو دالتون، بما في ذلك كا 2 + 3 5 أو IP، مما تسبب في وتحوير كا 2 + الإفراج من المخازن داخل الخلايا من الخلايا المجاورة 6 (الشكل 2). قنوات تقاطع الفجوة وينظم بإحكام بواسطة البينية بين الجزيئات والتفاعلات البروتين والعمليات مما يشير الخلوية، مثل تعديل الأكسدة والفسفرة 7. GJS تسهيل الاستجابة المنسقة من الخلايا متصلة، فيعمل كمادة كيميائية ومخلى الكهربائية. على سبيل المثال، انتشار إمكانات العمل القلب عبر myocytes الأذيني البطيني ويتم بوساطة قنوات GJ المستندة إلى معادل 85. CXS يكن لديك سوى دور كقنوات تقاطع الفجوة، ولكن أيضا تشكيل hemichannels المفردة، وبالتالي تعمل كقنوات في الأغشية على نحو مماثل لقنوات ايون العادية 8-10 (الشكل 1). المشاركة Hemichannels في إشارة نظير الصماوي بين الخلايا المجاورة عن طريق التحكم في تبادل الأيونات والجزيئات يشير بين البيئة داخل وخارج الخلية.
في العديد من أنواع الخلايا (مثل الخلايا الظهارية وخلايا بانية للعظم، الخلايا النجمية والخلايا البطانية، وغيرها) وأجهزة (مثل الدماغ والكبد وشبكية العين، القوقعة والأوعية الدموية)، بين الخلايا كا 2 + موجات أساسية لتنسيق الاستجابات المتعددة الخلايا <suP> 11. الزيادات في داخل الخلايا كا 2 + المستويات في خلية معينة لا تقتصر على هذه الخلية، ولكن تنتشر إلى الخلايا المجاورة المحيطة بها، وبالتالي إنشاء الكالسيوم بين الخلايا 2 + الموجة 12،13. هذه بين الخلايا كا 2 + موجات مهمة لتنظيم فسيولوجية طبيعية من طبقات الخلايا باعتبارها مخلى وارتبط التقلبات مع العمليات الفيزيولوجية المرضية 11. في بطانة القرنية وظهارة، مجموعات مختلفة 14-24، بما في ذلك منطقتنا 25-33، ودرس آليات وأدوار الاتصالات بين الخلايا. في الخلايا غير منفعل، مثل الخلايا البطانية القرنية، واثنين من وسائط مختلفة من الاتصالات بين الخلايا تحدث 28،29، وهي فجوة التواصل بين الخلايا صلي والاتصالات بين الخلايا نظير الصماوي. ينطوي على فجوة الاتصال بين الخلايا صلي على التبادل المباشر للجزيئات إشارة عبر الفجوة التقاطعات 7. الفجوة و Juncالاتصالات بين الخلايا tional أمر بالغ الأهمية للحفاظ على توازن الأنسجة، والسيطرة على تكاثر الخلايا، وإنشاء استجابة المتزامنة للإجهاد خارج الخلية 10،34،35. في عدد من الحالات المرضية، يتم تقليل الفجوة اقتران تقاطع بسبب CXS المعيبة، والتي تؤثر بهذا الفجوة صلي الاتصالات بين الخلايا 36. وهذا يؤكد أهمية وتأثير فجوة الاتصال بين الخلايا صلي في الكائنات متعددة الخلايا. وعلى النقيض من فجوة الاتصال بين الخلايا صلي والاتصالات بين الخلايا نظير الصماوي ليست متوقفة على بدل خلية خلية، لأنه ينطوي على الافراج عن رسل خارج الخلية إنتشاري (الشكل 2). يتم إطلاق أنواع مختلفة من الجزيئات يشير في الفضاء خارج الخلية عن طريق إشارات الخلايا. ثم يتم نقل جزيء إلى الخلية المستهدفة حيث يتم الكشف عنها بواسطة بروتين مستقبلات محددة. وفي وقت لاحق مجمع مستقبلات إشارة يؤدي الى استجابة الخلوية، التييتم إنهاء عن طريق إزالة إشارة، تعطيل أو إزالة التحسس. صدر محبة للدهون رسل إشارة خارج الخلية اختراق الغشاء وتعمل على مستقبلات الخلايا. في المقابل، رسل ماء لا عبور الغشاء البلازمي للخلية الاستجابة، ولكن بمثابة يجند التي تربط لسطح أعرب البروتينات المستقبلة، التي تتابع بعد ذلك إشارة إلى البيئة داخل الخلايا. ثلاث عائلات رئيسية من البروتينات مستقبلات سطح الخلية المشاركة في هذه العملية: ايون قناة مرتبطة، المرتبط بالإنزيم، وربط بروتين G. الجزيء رسول صدر يمكن أن تعمل على المستقبلات من نفس الخلية (autocrine)، على الخلايا المستهدفة على مقربة (نظير الصماوي)، أو على الخلايا المستهدفة البعيدة التي تتطلب نظام الدورة الدموية (الغدد الصماء).
في العديد من أنواع الخلايا، بما في ذلك بطانة القرنية 28،29، ATP هو واحد من عوامل نظير الصماوي ماء الرئيسية التي تدفع انتشار بين الخلايا كا 2 + موجات 37-40. الدرجي تشوه الميكانيكية، نقص الأكسجة، التهاب أو التحفيز من قبل وكلاء مختلف، ATP يمكن أن تنطلق من الخلايا السليمة 41-44 استجابة لإجهاد القص، وتمتد، أو ناضح تورم 44،45. وقد افترض آليات ATP-الافراج مختلفة، بما في ذلك إيماس حويصلي 44 وعدد كبير من آليات النقل، مثل راديو كاسيت ATP ملزم (ABC) الناقلون، قنوات أنيون التي تعتمد على الجهد البلازمي 46، P2X7 قنوات مستقبلات 47،48، وكذلك hemichannels connexin 49-52 وhemichannels pannexin 43،49،53. ATP خارج الخلية يمكن ان تحلل بسرعة إلى ADP، AMP والأدينوساين 54،55 من قبل ectonucleotidases التي تكون موجودة في البيئة خارج الخلية. سوف ATP صدر خارج الخلية والمستقلب ADP 56 ينتشر عن طريق نشرها. وقد تورط التفاعل اللاحقة من هذه النيوكليوتيدات مع مستقبلات purinergic في الخلايا المجاورة في عropagation من بين الخلايا كا 2 + موجات 28،37،51. فئتين مختلفتين من المستقبلات purinergic موجودة: الأدينوزين هو يجند الطبيعية الرئيسية لP1-purinoceptors، في حين أن كلا البيورين (ATP، ADP) وبيريميدين (UTP، UDP) النيوكليوتيدات تعمل على معظم P2-purinoceptors 57.
الاتصالات بين الخلايا يمكن التحقيق من قبل وسائل مختلفة مثل تحميل كشط، ونقل صبغ، uncaging المحلية من منبهات مثل IP 3 والكالسيوم 2 +، التحفيز الميكانيكي، الخ. نحن هنا وصف دراسة كا 2 + موجة الانتشار التي تسببها التحفيز الميكانيكي من خلية واحدة. الاستفادة من دراسة كا 2 + انتشار الموجة عن طريق التحفيز الميكانيكي هو أنه يوفر أداة سهلة لقياس انتشار كا 2 + الموجة مع مرور الوقت وأنه يسمح بمقارنة كميا المعالجة المسبقة مختلفة من الخلايا. في بطانة القرنية، وهذه كا 2 + بين الخلايا موجات تسمح لشركةاستجابة منسقة من أحادي الطبقة، وهو يتصرف بموجب كآلية دفاع ممكن من بطانة القرنية غير التجدد مساعدة البطانة على تحمل الضغوط خارج الخلية أثناء الجراحة داخل العين، أو عند التعرض للالتهابات وسطاء خلال الرفض المناعي أو التهاب القزحية 58،59.
في هذا المخطوط، ونحن تصف طريقة بسيطة لقياس بين الخلايا كا 2 + انتشار الموجة في الطبقات الوحيدة من الأبقار الخلايا البطانية القرنية الأولية عن طريق توفير التحفيز الميكانيكي المترجمة والتي تسيطر عليها باستخدام micropipette. الخلايا حفز ميكانيكيا الاستجابة مع زيادة ال…
The authors have nothing to disclose.
وأيد أعمال البحث التي أجريت في المختبر من المنح المقدمة من مؤسسة أبحاث – فلاندرز (FWO؛ أرقام منحة G.0545.08 وG.0298.11)، وبين الجامعات الجذب برنامج البولنديين (سياسة العلوم البلجيكي؛ منح عدد P6/28 وP7/13) ومضمن في الأوساط البحثية FWO المدعومة. CDH هو زميل ما بعد الدكتوراه من مؤسسة البحوث – فلاندرز (FWO). المؤلفون ممتنون جدا لجميع الأعضاء الحاليين والسابقين في مختبر الجزيئية والخلوية اشارة (جامعة لوفين الكاثوليكية)، د. SP سرينيفاس (مدرسة جامعة إنديانا في علم البصريات، الولايات المتحدة الأمريكية)، ومختبر الدكتور Leybaert (جامعة غنت) ولل د. Vinken (VUB) الذين قدموا مناقشات مفيدة، إلى أقصى حد أو الإجراءات شاركوا في تطوير أدوات لدراسة hemichannels connexin.
Name of Reagent/Material | Company | Catalog Number | Column1 |
Earle’s Balanced Salt Solution (EBSS) | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 14155-048 | |
Iodine | Sigma-Aldrich (Deisenhofen, Germany) | 38060-1EA | |
Dulbecco’s Modified Eagle’s Medium (DMEM) | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 11960-044 | |
L-glutamine (Glutamax) | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 35050-038 | |
Amphotericin-B | Sigma-Aldrich (Deisenhofen, Germany) | A2942 | |
Antibiotic-antimycotic mixture | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 15240-096 | |
Trypsin | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 25300-054 | |
Dulbecco’s PBS | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | 14190-091 | |
Fluo-4 AM | Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany) | F14217 | |
ARL-67156 (6-N,N-Diethyl-b,g-dibromomethylene-D-ATP) | Sigma-Aldrich (Deisenhofen, Germany) | A265 | |
Apyrase VI | Sigma-Aldrich (Deisenhofen, Germany) | A6410 | |
Apyrase VII | Sigma-Aldrich (Deisenhofen, Germany) | A6535 | |
Gap26 (VCYDKSFPISHVR) | Custom peptide synthesis | ||
Gap27 (SRPTEKTIFII) | Custom peptide synthesis | ||
Control Peptide (SRGGEKNVFIV) | Custom peptide synthesis | ||
siRNA1 Cx43 (sense: 5’GAAGGAGGAGGAACU-CAAAdTdT) | Annealed siRNA was purchased at Eurogentec (Luik, Belgium) | ||
siRNA2 Cx43 (sense: 5’CAAUUCUUCCUGCCGCAAUdTdT) | Annealed siRNA was purchased at Eurogentec (Luik, Belgium) | ||
siRNA scramble: scrambled sequence of siCx43-1 (sense: 5’GGUAAACG-GAACGAGAAGAdTdT) | Annealed siRNA was purchased at Eurogentec (Luik, Belgium) | ||
TAT-L2 (TAT- DGANVDMHLKQIEIKKFKYGIEEHGK) | Thermo Electron (Ulm, Germany) | ||
TAT-L2-H126K/I130N (TAT-DGANVDMKLKQNEIKKFKYGIEEHGK) | Thermo Electron (Ulm, Germany) | ||
Two chambered glass slides | Laboratory-Tek Nunc (Roskilde, Denmark) | 155380 | |
Confocal microscope | Carl Zeiss Meditec (Jena, Germany) | LSM510 | |
Piezoelectric crystal nanopositioner (Piezo Flexure NanoPositioner) | PI Polytech (Karlsruhe, Germany) | P-280 | |
HVPZT-amplifier | PI Polytech (Karlsruhe, Germany) | E463 HVPZT-amplifier | |
Glass tubes (glass replacement 3.5 nanoliter) | World Precision Instruments, Inc. Sarasota, Florida, USA | 4878 | |
Microelectrode puller | Zeitz Instrumente (Munchen, Germany) | WZ DMZ-Universal Puller |